Up the Level with WBT

Convert TerraClassicUSD
USTCUSTCUSTC
to Enzyme Finance
MLNMLNMLN

Enjoy stress-free trading with a 0% conversion commission and a 10-second price freeze. Secure your rate and trade with peace of mind, knowing you’re always getting the best deal.

USTC
≈ 0
DAIANKRSUIZECCHZICPUSDCXMRBTTAPEPEVETNEOADACOMPKAVALDOAVAXACESHIBSNXALGOICXHBARINJBATDOTBTCGRTYFIADXSUSHIBCHMANAIMXLINKLTCXAUTOPFXSXTZAIXBTNEXOTRXETHACTAGLDTUSDACHXLMEGLDSANDARUSDTAMBAXSTHETANEARDYDXARBALLOAPI3AEVOAERGOWBTATOMANIMEACXETCDOGEZRXMKRASTRLRCAPTALTZENDASH0GXDCALICEGALAFILAIXRPSOLUNIAAVEAGRSBNT1INCH2ZFLOWLUNCAGENTAITECHAMPSFMCRVAPEDAIANKRSUIZECCHZICPUSDCXMRBTTAPEPEVETNEOADACOMPKAVALDOAVAXACESHIBSNXALGOICXHBARINJBATDOTBTCGRTYFIADXSUSHIBCHMANAIMXLINKLTCXAUTOPFXSXTZAIXBTNEXOTRXETHACTAGLDTUSDACHXLMEGLDSANDARUSDTAMBAXSTHETANEARDYDXARBALLOAPI3AEVOAERGOWBTATOMANIMEACXETCDOGEZRXMKRASTRLRCAPTALTZENDASH0GXDCALICEGALAFILAIXRPSOLUNIAAVEAGRSBNT1INCH2ZFLOWLUNCAGENTAITECHAMPSFMCRVAPE

How to Convert USTC to MLN?

Convert crypto online for national currency or exchange one digital asset for another in a matter of seconds

  • Step 1

    Choose an Asset

    Indicate the asset you want to “Give” and the asset you want to “Receive” from the assets available on the exchange

  • Step 2

    Indicate the Amount

    Specify the amount of asset you want to exchange. You will be able to see the USDT equivalent for both the asset you give and the asset you receive

  • Step 3

    Use the Converted Assets

    After converting crypto or fiat, you can find the assets you exchanged by clicking the “Go to Balance” button. You can find info about all transactions in the “Convert” section in your History

USTC/USDT Conversion Calculator

USTC to USDT values from Today at 09:34

  • 0.5 USTC0 USDT
  • 1 USTC0 USDT
  • 5 USTC0.02 USDT
  • 10 USTC0.04 USDT
  • 50 USTC0.22 USDT
  • 100 USTC0.44 USDT
  • 500 USTC2.22 USDT
  • 1000 USTC4.45 USDT

USDT to USTC values from Today at 09:34

  • 0.5 USDT112.35955056 USTC
  • 1 USDT224.71910112 USTC
  • 5 USDT1,123.59550561 USTC
  • 10 USDT2,247.19101123 USTC
  • 50 USDT11,235.95505617 USTC
  • 100 USDT22,471.91011235 USTC
  • 500 USDT112,359.55056179 USTC
  • 1000 USDT224,719.10112359 USTC

WhiteBIT Advantages

We specialize in safety, convenience, and speed of operations. Convert crypto to crypto or state currencies within split seconds and enjoy the robustness of our functionality.

Crypto Converter Calculator

You can see the price of any selected asset in USDT equivalent

Crypto Converter Calculator

Rate Fixation

The price of the selected asset fixates with the possibility to renew it every 10 seconds

Simple Interface

Conduct operations in one tab

All Assets

Convert any assets available on the exchange

Convert via WhiteBIT API

Incorporate this feature into your platforms and experience swift, high-quality cryptocurrency exchange via WhiteBIT's multifunctional API service

Current Exchange Rate of USTC to USDT

1 USTC = 0.00445 USDT. The current value of 1 USTC is now +0.44% compared to the exchange rate of USDT over the last 24 hours. Over the last hour, the price of USTC has changed by +0.22%, resulting in an absolute change in value of 0.00445 USDT. Create an account on WhiteBIT to fully utilize the cryptocurrency converter for exchanging USTC/USDT.

Join WhiteBIT

Convert Crypto and National Currencies Instantly

FAQ

If you still have questions, you can ask the support team or read the Help Center

To convert USTC/MLN on WhiteBIT, go to the "Buy Crypto" tab and select "Convert". Then select the two currencies you want to exchange between them. In the "Give" field, enter the amount you want to exchange. The "Receive" field will be filled in automatically, and the amount you will receive in your wallet will appear, considering the fee.
There is no fee for exchanging USTC/MLN on our platform. Enjoy a 0% commission on all transactions. The exchange rate is locked for 10 seconds to ensure you receive the rate you see.
The process of converting USTC/MLN on WhiteBIT usually takes several minutes or takes place instantly.